nag

Модуль SFP WDM, дальность до 20км (14dB), 1310нм, 100Mb купить по низкой цене - НАГ

$11.18

Dynamics of prices

Description

Купить Модуль SFP WDM, дальность до 20км (14dB), 1310нм, 100Mb оптом и в розницу по низкой цене. Доставка по России. Одноволоконный модуль, SFP WDM 100Base-FX, разъем SC, рабочая длина волны Tx/Rx: 1310/1550нм, дальность до 20км (14dB), с поддержкой функции DDM

Similar products

Аминокислота глутамин Biotech USA Glutamine peptide 180 капс. BioTechUSA 14662918 в интернет-магазине Wildberries.ru
wildberries
16.81 $
Аминокислота глутамин Biotech USA Glutamine peptide 180 капс. BioTechUSA 14662918 в интернет-магазине Wildberries.ru
-
Few orders
Усилитель Behringer NX3000: купить по цене от 17717 р. в интернет-магазинах Москвы, характеристики, фото, доставка
price
230.03 $
Усилитель Behringer NX3000: купить по цене от 17717 р. в интернет-магазинах Москвы, характеристики, фото, доставка
-
Few orders
Кабель магнитный тканевый Type C FINITY 15156738 в интернет-магазине Wildberries.ru
wildberries
2.84 $
Кабель магнитный тканевый Type C FINITY 15156738 в интернет-магазине Wildberries.ru
-
Few orders
Купить коттедж 250м² Ленинградская область, Всеволожский район, Бугровское с/пос, Мистолово деревня м. Парнас - база ЦИАН, объявление 228749073
cian
454427.42 $
Купить коттедж 250м² Ленинградская область, Всеволожский район, Бугровское с/пос, Мистолово деревня м. Парнас - база ЦИАН, объявление 228749073
-
Few orders
Купить Total War: Shogun 2 - DLC Dragon War Battle Pack и скачать
plati
0.9 $
Купить Total War: Shogun 2 - DLC Dragon War Battle Pack и скачать
-
Few orders
Профили Т образные стальные в Нижнем Новгороде купить недорого ▼
yavitrina
44.79 $
Профили Т образные стальные в Нижнем Новгороде купить недорого ▼
-
Few orders
Шкаф ШГ-800 Риф лайм матовый/Прованс (Стекло) купить в Чайковском, цена 4 170 руб., размеры 800х706х317  — интернет-магазин «ДомаДом»
SearchPlacePhoneAccountShopping cart
dom-a-dom
54.14 $
Шкаф ШГ-800 Риф лайм матовый/Прованс (Стекло) купить в Чайковском, цена 4 170 руб., размеры 800х706х317 — интернет-магазин «ДомаДом» SearchPlacePhoneAccountShopping cart
-
Few orders
Гудмэн Шампунь Доктор восстанавливающий для кошек, флакон 200 мл - купить, цена и отзывы, Гудмэн Шампунь Доктор восстанавливающий для кошек, флакон 200 мл инструкция по применению, дешевые аналоги, описание, заказать в Москве с доставкой на домLogo of EaptekaElements/Icons/sale/normalElements/Icons/sprinkler/normalElements/Icons/doctor-bag/normal CopyElements/Icons/nose/normalElements/Icons/cistit/normalElements/Icons/sprinkler/normalElements/Icons/more/normal
eapteka
5.48 $
Гудмэн Шампунь Доктор восстанавливающий для кошек, флакон 200 мл - купить, цена и отзывы, Гудмэн Шампунь Доктор восстанавливающий для кошек, флакон 200 мл инструкция по применению, дешевые аналоги, описание, заказать в Москве с доставкой на домLogo of EaptekaElements/Icons/sale/normalElements/Icons/sprinkler/normalElements/Icons/doctor-bag/normal CopyElements/Icons/nose/normalElements/Icons/cistit/normalElements/Icons/sprinkler/normalElements/Icons/more/normal
-
Few orders
Игристое вино красное сухое Civ&Civ Le Foglie Lambrusco di Modena урожая 2019 года 0.75л (Чив & Чив Ле Фолье Ламбруско ди Модена ), купить в магазине в Санкт-Петербурге - цена, отзывы
l-wine
6.5 $
Игристое вино красное сухое Civ&Civ Le Foglie Lambrusco di Modena урожая 2019 года 0.75л (Чив & Чив Ле Фолье Ламбруско ди Модена ), купить в магазине в Санкт-Петербурге - цена, отзывы
-
Few orders
PicClick IT
picclick
109.87 $
PicClick IT
-
Few orders
CLASSIC SHORTY (короткая) L STEM (стебель) менструальная чаша  Me Luna® 11205004 в интернет-магазине Wildberries.ru
wildberries
21.35 $
CLASSIC SHORTY (короткая) L STEM (стебель) менструальная чаша Me Luna® 11205004 в интернет-магазине Wildberries.ru
-
Few orders
Купить Бисер японский TOHO Cube кубический 4мм #0344 хрусталь/темно-серый, окрашенный изнутри, 5 грамм
melodiabisera
1.15 $
Купить Бисер японский TOHO Cube кубический 4мм #0344 хрусталь/темно-серый, окрашенный изнутри, 5 грамм
-
Few orders
Спортивні чохли
com
3.01 $
Спортивні чохли
-
Few orders
Creative GigaWorks T20 Series II  – купить компьютерные колонки, сравнение цен интернет-магазинов: фото, характеристики, описание | E-Katalog
e-katalog
77.51 $
Creative GigaWorks T20 Series II – купить компьютерные колонки, сравнение цен интернет-магазинов: фото, характеристики, описание | E-Katalog
-
Few orders
Умные часы Smart Baby Watch D99 всего за 2 300 руб. в интернет-магазине Electro-man.ru chatkeysearchlockbulblocationmaillikepaperplanebanknotedatamegaphonet-shirtfireclipcalendarwallettruckat-signawardbar-chartbellcameracredit-cardheadphonesheartmap-pinmicphone-callprintershieldshopping-cartthumbs-uptvpencil2feedlibraryfile-text2qrcodemap2alarmdisplaylaptopmobilegiftaccessibilityeyeeye-blockedsmileinfocheckmarkloop2infinitetwittertelegramskypefacebookvkyoutubewhatsapp
electro-man
29.86 $
Умные часы Smart Baby Watch D99 всего за 2 300 руб. в интернет-магазине Electro-man.ru chatkeysearchlockbulblocationmaillikepaperplanebanknotedatamegaphonet-shirtfireclipcalendarwallettruckat-signawardbar-chartbellcameracredit-cardheadphonesheartmap-pinmicphone-callprintershieldshopping-cartthumbs-uptvpencil2feedlibraryfile-text2qrcodemap2alarmdisplaylaptopmobilegiftaccessibilityeyeeye-blockedsmileinfocheckmarkloop2infinitetwittertelegramskypefacebookvkyoutubewhatsapp
-
Few orders