wildberries

Дезодорант-антиперспирант Дыхание и Защита гель мужской, 85г. MENNEN SPEED STICK 2957792 в интернет-магазине Wildberries

Few orders
$5.57

Dynamics of prices

Product reviews 0

There are no reviews of this product yet. If you have bought this product, be the first to share an opinion on it!

Similar products

Купить товары Nike в Москве | Sneakerhead
sneakerhead
112.17 $
Купить товары Nike в Москве | Sneakerhead
-
Few orders
Мульти-табс Бэби капли 30мл купить в Москве по цене от 399 рублей
stolichki
5.12 $
Мульти-табс Бэби капли 30мл купить в Москве по цене от 399 рублей
-
Few orders
Crunchies Apples, Blueberries, Strawberries & Bananas, 1Oz/28 g: Buy Online at Best Price in UAE - Amazon.ae
amazon
5.2 $
Crunchies Apples, Blueberries, Strawberries & Bananas, 1Oz/28 g: Buy Online at Best Price in UAE - Amazon.ae
-
Few orders
10.5 Планшет Apple iPad Air 2019 64 ГБ серебристыйchatkeysearchlockbulblocationmaillikepaperplanebanknotedatamegaphonet-shirtfireclipcalendarwallettruckat-signawardbar-chartbellcameracredit-cardheadphonesheartmap-pinmicphone-callprintershieldshopping-cartthumbs-uptvpencil2feedlibraryfile-text2qrcodemap2alarmdisplaylaptopmobilegiftaccessibilityeyeeye-blockedsmileinfocheckmarkloop2infinitetwittertelegramskypefacebookvkyoutubewhatsapp
onitoka
391.6 $
10.5 Планшет Apple iPad Air 2019 64 ГБ серебристыйchatkeysearchlockbulblocationmaillikepaperplanebanknotedatamegaphonet-shirtfireclipcalendarwallettruckat-signawardbar-chartbellcameracredit-cardheadphonesheartmap-pinmicphone-callprintershieldshopping-cartthumbs-uptvpencil2feedlibraryfile-text2qrcodemap2alarmdisplaylaptopmobilegiftaccessibilityeyeeye-blockedsmileinfocheckmarkloop2infinitetwittertelegramskypefacebookvkyoutubewhatsapp
-
Few orders
220 Volt
220-volt
11.53 $
220 Volt
-
Few orders
Чехол универсальный силиконовый бампер для планшета 7 дюймов Adamar 12668076 в интернет-магазине Wildberries
wildberries
4.55 $
Чехол универсальный силиконовый бампер для планшета 7 дюймов Adamar 12668076 в интернет-магазине Wildberries
-
Few orders
Металлоискатель АКА купить в интернет-магазине МДРегион - Металлоискатели в Барнауле. Фирменный магазин МДРегион - Барнаул, Магазин металлоискателей
md22
456.52 $
Металлоискатель АКА купить в интернет-магазине МДРегион - Металлоискатели в Барнауле. Фирменный магазин МДРегион - Барнаул, Магазин металлоискателей
-
Few orders
Adaptador Receptor Bluetooth Usb Pendrive Carro Musica Mp3
com
2.04 $
Adaptador Receptor Bluetooth Usb Pendrive Carro Musica Mp3
-
Few orders
Шоколад Спартак горький 56%, 500 гр. (крафт) 4810067081968 - низкая цена, доставка или самовывоз по Челябинску. Шоколад Спартак горький 56%, 500 гр. (крафт) купить в интернет магазине ОНЛАЙН ТРЕЙД.РУ
onlinetrade
6.4 $
Шоколад Спартак горький 56%, 500 гр. (крафт) 4810067081968 - низкая цена, доставка или самовывоз по Челябинску. Шоколад Спартак горький 56%, 500 гр. (крафт) купить в интернет магазине ОНЛАЙН ТРЕЙД.РУ
-
Few orders
Купить кроссовки Найк (Nike) в Москве от 4 090 рублей – интернет-магазин Sneakerhead
sneakerhead
204.2 $
Купить кроссовки Найк (Nike) в Москве от 4 090 рублей – интернет-магазин Sneakerhead
-
Few orders
корзина проволочная  с доводчиком 53-41651 465*600*140 хромsale2
deks
0.07 $
корзина проволочная с доводчиком 53-41651 465*600*140 хромsale2
-
Few orders
Тарелка "Новогодний букет" 19 см в Москве. Купить по цене   290  руб.
lavandadecor
3.72 $
Тарелка "Новогодний букет" 19 см в Москве. Купить по цене 290 руб.
-
Few orders
Грузовик KIA Trade
farpost
2565.41 $
Грузовик KIA Trade
-
Few orders
MakeUP
com
24.19 $
MakeUP
-
Few orders
Nike кеды Killshot OG SP - купить в интернет магазине в Москве | Цены, Фото.
farfetch
116.39 $
Nike кеды Killshot OG SP - купить в интернет магазине в Москве | Цены, Фото.
-
Few orders