com

Hub Usb 2.0 4 Portas Plug And Play Hi-speed

Pocos pedidos
$7.21

Dinámica de precios

Reseñas de productos 0

No hay reseñas para este producto todavía. Si ha comprado este producto, ¡sea el primero en compartir sus impresiones!

Productos similares

Антибактериальный биоразлагаемый гель для мытья посуды, овощей и фруктов с ароматом лимона, 5 л SYNERGETIC 14453274 в интернет-магазине Wildberries
wildberries
5.5 $
Антибактериальный биоразлагаемый гель для мытья посуды, овощей и фруктов с ароматом лимона, 5 л SYNERGETIC 14453274 в интернет-магазине Wildberries
-
Pocos pedidos
Продажа двухкомнатной квартиры 48м² ул. Институтская, 2, Московская область, Красногорск городской округ, Нахабино рп м. Нахабино - база ЦИАН, объявление 241583410
cian
73114.42 $
Продажа двухкомнатной квартиры 48м² ул. Институтская, 2, Московская область, Красногорск городской округ, Нахабино рп м. Нахабино - база ЦИАН, объявление 241583410
-
Pocos pedidos
10.5 Планшет Apple iPad Air 2019 64 ГБ 3G, LTE серебристыйchatkeysearchlockbulblocationmaillikepaperplanebanknotedatamegaphonet-shirtfireclipcalendarwallettruckat-signawardbar-chartbellcameracredit-cardheadphonesheartmap-pinmicphone-callprintershieldshopping-cartthumbs-uptvpencil2feedlibraryfile-text2qrcodemap2alarmdisplaylaptopmobilegiftaccessibilityeyeeye-blockedsmileinfocheckmarkloop2infinitetwittertelegramskypefacebookvkyoutubewhatsapp
onitoka
491.78 $
10.5 Планшет Apple iPad Air 2019 64 ГБ 3G, LTE серебристыйchatkeysearchlockbulblocationmaillikepaperplanebanknotedatamegaphonet-shirtfireclipcalendarwallettruckat-signawardbar-chartbellcameracredit-cardheadphonesheartmap-pinmicphone-callprintershieldshopping-cartthumbs-uptvpencil2feedlibraryfile-text2qrcodemap2alarmdisplaylaptopmobilegiftaccessibilityeyeeye-blockedsmileinfocheckmarkloop2infinitetwittertelegramskypefacebookvkyoutubewhatsapp
-
Pocos pedidos
Сдам двухкомнатную квартиру 53.7м² Литовский бул., 34, Москва, ЮЗАО, р-н Ясенево м. Ясенево - база ЦИАН, объявление 242671682
cian
551.56 $
Сдам двухкомнатную квартиру 53.7м² Литовский бул., 34, Москва, ЮЗАО, р-н Ясенево м. Ясенево - база ЦИАН, объявление 242671682
-
Pocos pedidos
Плащ Baon 7055889 в интернет-магазине Wildberries
wildberries
56.09 $
Плащ Baon 7055889 в интернет-магазине Wildberries
-
Pocos pedidos
TyresAddict
tyresaddict
60.27 $
TyresAddict
-
Pocos pedidos
Thank You For Your Friendship Funny Food Coffee Mug – Simply Crafty
shopsimplycrafty
19.99 $
Thank You For Your Friendship Funny Food Coffee Mug – Simply Crafty
-
Pocos pedidos
Markerkant 12 1 5
fundainbusiness
819 $
Markerkant 12 1 5
-
Pocos pedidos
Цвет 201 нитки Dor Tak №60/2 4500м - Швейный Мир
sewing-world
2.57 $
Цвет 201 нитки Dor Tak №60/2 4500м - Швейный Мир
-
Pocos pedidos
POLYSCIAS FABIAN Planta - Aralia 24 cm
ikea
29.25 $
POLYSCIAS FABIAN Planta - Aralia 24 cm
-
Pocos pedidos
Спальня Alivio - купить мебель для спальни Аливио в Москве  и МО от Дятьково
dyatkovo
0.03 $
Спальня Alivio - купить мебель для спальни Аливио в Москве и МО от Дятьково
-
Pocos pedidos
Кольцо с белым нефритом Чистота – купить на Ярмарке Мастеров – KUPGURU | Кольца, Иркутск
livemaster
38.48 $
Кольцо с белым нефритом Чистота – купить на Ярмарке Мастеров – KUPGURU | Кольца, Иркутск
-
Pocos pedidos
Whey Protein Isolado Pote 900g - Dux Nutrition
com
30.6 $
Whey Protein Isolado Pote 900g - Dux Nutrition
-
Pocos pedidos
Кардиган CESARE FABINI 13788261 в интернет-магазине Wildberries
wildberries
30.36 $
Кардиган CESARE FABINI 13788261 в интернет-магазине Wildberries
-
Pocos pedidos
Стоит ли покупать Рюкзак Cozistyle Leather Urban Backpack Travel? Отзывы на Яндекс.Маркете
yandex
101.33 $
Стоит ли покупать Рюкзак Cozistyle Leather Urban Backpack Travel? Отзывы на Яндекс.Маркете
-
Pocos pedidos